Active human TNF Receptor II protein fragment (ab83541)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSD TVCDSCED STYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC RPGWYCALSKQEGCRLC APLRKCRPGFGVARPGTETSDVVCKPCAPGT FSNTTSSTDICRPHQICNVVAIPGNASMD AVCTSTSPTRSMAPGAVHL PQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGIPK VDKKVEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH ED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K
    • Amino acids23 to 253

Specifications

Our Abpromise guarantee covers the use of ab83541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe ND50 of TNF Receptor II-Fc Chimera is typically 20-50 ng/ml as measured by its ability to neutralize TNF-a mediated cytoxicity in murine WEHI 164 cells in the presence of actinomycin D.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General info

  • Alternative names
    • CD120b
    • p75
    • p75TNFR
    • p80 TNF alpha receptor
    • p80 TNF-alpha receptor
    • TBP-2
    • TBPII
    • TNF R2
    • TNF R75
    • TNF-R2
    • TNF-RII
    • TNFBR
    • TNFR-II
    • TNFR1B
    • TNFR2
    • TNFR80
    • TNFRII
    • TNFRSF1B
    • TNR1B_HUMAN
    • Tumor necrosis factor receptor 2
    • Tumor necrosis factor receptor superfamily member 1B
    • Tumor necrosis factor receptor type II
    • Tumor necrosis factor-binding protein 2
    see all
  • FunctionReceptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
  • Sequence similaritiesContains 4 TNFR-Cys repeats.
  • Post-translational
    modifications
    Phosphorylated; mainly on serine residues and with a very low level on threonine residues.
    A soluble form (tumor necrosis factor binding protein 2) is produced from the membrane form by proteolytic processing.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Active human TNF Receptor II protein fragment images

  • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates that ab83541 exists in multiple isoforms, which differ according to their level of post-translational modification. Expression of these isoforms is highly significant for cell biology, as they more closely resemble the native human proteins.
    The triangle indicates theoretical pI and MW of the protein.

References for Active human TNF Receptor II protein fragment (ab83541)

ab83541 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"