Active human Transferrin full length protein (ab83560)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASY L DCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKED PQTF YYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLL YCDLPEP RKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCS TLNQYFGYSG AFKCLKNGAGDVAFVKHSTIFENLANKADRDQYEL LCLDNTRKPVDEY KDCHLAQVPSHTVVARSMGGKEDLIWELLNQA QEHFGKDKSKEFQLFS SPHGKDLLFKDSAHGFLKVPPRMDAKMYL GYEYVTAIRNLREGTCQEA PTDECKPVKWCALSHHERLKCDEWSV NSVGKIECVSAETTEDCIAKIM NGEADAMSLDGGFVYIAGKCGLV PVLAENYNKSDNCEDTPEAGYFAVA VVKKSASDLTWDNLKGKKSC HTAVGRTAGWNIPMGLLYNKINHCRFDE FFSEGCAPGSKKDSSLC KLCMGSGLNLCEPNNKEGYYGYTGAFRCLVE KGDVAFVKHQTVPQ NTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEY ANCHLARAPNH AVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLF RSETKDLL FRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSL LEACT FRRP
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab83560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe activity of ab83560 was measured by its ability to support the growth of HepG2 cells under conditions of reduced serum. Typically 0.1 to 1 µg enhances cell proliferation.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.

General info

  • Alternative names
    • Apotransferrin
    • Beta 1 metal binding globulin
    • Beta-1 metal-binding globulin
    • DKFZp781D0156
    • PRO1400
    • PRO1557
    • PRO2086
    • Serotransferrin
    • Serotransferrin precursor
    • Siderophilin
    • TF
    • TFQTL1
    • Transferin
    • Transferrin
    • TRFE_HUMAN
    see all
  • FunctionTransferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation.
  • Tissue specificityExpressed by the liver and secreted in plasma.
  • Involvement in diseaseDefects in TF are the cause of atransferrinemia (ATRAF) [MIM:209300]. Atransferrinemia is rare autosomal recessive disorder characterized by iron overload and hypochromic anemia.
  • Sequence similaritiesBelongs to the transferrin family.
    Contains 2 transferrin-like domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Active human Transferrin full length protein images

  • Standard curve for Transferrin (Analyte: ab83560); dilution range 1pg/ml to 1µg/ml using Capture Antibody Mouse monoclonal [HTF-14] to Transferrin (ab769) at 1µg/ml and Detector Antibody Rabbit polyclonal to Transferrin (ab9538) at 0.5µg/ml.
  • Lane 1 – MW markers; Lane 2 – ab83560; Lane 3 – ab83560 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83560 treated with a glycosidase cocktail to remove potential N- and Olinked glycans. Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
  • A sample of ab83560 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris HCl 2D gel. Approximately 40 µg of protein was load; Gel was stained using Deep Purple™. Spot train indicates presence of multiple isoforms of Transferrin. Spots within the spot train were cut from the gel and identified as Transferrin by protein mass fingerprinting.
  • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates that ab83560 exists in multiple isoforms, which differ according to their level of posttranslational modification. Expression of these isoforms is highly significant for cell biology, as they more closely resemble the native human proteins. The triangle indicates theoretical pI and MW of the protein.

References for Active human Transferrin full length protein (ab83560)

ab83560 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"