Active human VEGF 165A full length protein (ab83572)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence; APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEY PDEIEYIFKPSCVPLMRCG GCCNDEGLECVPTEESNITMQIMRIKPHQ GQHIGEMSFLQHNKCECRPKKDRARQEN PCGPCSERRKHLFVQDPQTC KCSCKNTDSRCKARQLELNERTCRCDKPRR
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab83572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe ED50 of ab83572 is typically 0.2 - 2.0 ng/ml as measured in a cell proliferation assay using human umbilical vein endothelial (HUVEC) cells.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Additional NotesUnmodified human VEGF 165 has a predicted pI of 7.6.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • glioma-derived endothelial cell mitogen
    • MGC70609
    • MVCD1
    • Vascular Endothelial Growth Factor
    • Vascular endothelial growth factor A
    • Vascular permeability factor
    • Vascular permeability factor
    • VEGF
    • VEGF-A
    • VEGF165
    • VEGFA
    • VEGFA_HUMAN
    • VPF
    see all
  • FunctionGrowth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
  • Tissue specificityIsoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
  • Involvement in diseaseDefects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similaritiesBelongs to the PDGF/VEGF growth factor family.
  • Cellular localizationSecreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.
  • Target information above from: UniProt accession P15692 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

References for Active human VEGF 165A full length protein (ab83572)

ab83572 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. The sequences are as follows:
ab9571: two polypeptide chains with the sequence APMAEGGGQN HHEVVKFMDV YQRSYCHPIE TLVDIFQEYP DEIEYI FKPS CVPLMRCGGCCNDEGLECVP TEESNITMQI MRI KPHQGQH IGEMSFLQHN KCECRPKKDR ARQENPCGPC SERRKH...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"