Active human VEGF Receptor 2 protein fragment (ab54347)

Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • AccessionP35968
    • SpeciesHuman
    • SequenceASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSG SEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQ DYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKR FVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVV GYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQH KKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNS TFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGI PLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYV PPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANE PSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVI QAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSL WCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSN STNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTI TGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGN RNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGA
    • Molecular weight116 kDa
    • Amino acids20 to 757

Specifications

Our Abpromise guarantee covers the use of ab54347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % by SDS-PAGE.
    ab54347 was visualised on SDS Page by Silver stain.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 100mM Sodium chloride, 10mM Tris, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in water or PBS to a concentration of not lower than 100 µg/ml.

General info

  • Alternative names
    • CD309
    • CD309 antigen
    • Fetal liver kinase 1
    • FLK-1
    • FLK1
    • KDR
    • Kinase insert domain receptor
    • Kinase insert domain receptor (a type III receptor tyrosine kinase)
    • KRD1
    • Ly73
    • Protein tyrosine kinase receptor FLK1
    • Protein-tyrosine kinase receptor flk-1
    • Tyrosine kinase growth factor receptor
    • Vascular endothelial growth factor receptor 2
    • VEGFR
    • VEGFR 2
    • VEGFR-2
    • VEGFR2
    • VGFR2_HUMAN
    see all
  • FunctionReceptor for VEGF or VEGFC. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
  • Involvement in diseaseDefects in KDR are associated with susceptibility to hemangioma capillary infantile (HCI) [MIM:602089]. HCI are benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium. They are the most common tumor of infancy, occurring in up to 10% of all births. Hemangiomas tend to appear shortly after birth and show rapid neonatal growth for up to 12 months characterized by endothelial hypercellularity and increased numbers of mast cells. This phase is followed by slow involution at a rate of about 10% per year and replacement by fibrofatty stroma.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated. Dephosphorylated by PTPRB. Dephosphorylated by PTPRJ at Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214.
  • Cellular localizationMembrane.
  • Information by UniProt

Active human VEGF Receptor 2 protein fragment images

References for Active human VEGF Receptor 2 protein fragment (ab54347)

ab54347 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry regarding ab106041 and for taking the time to provide some useful details of the experiments. I am very sorry to hear that you are having problems with this antibody.

After reading through the detailed protocol you k...

Read More

Thank you for contacting us.

The antibodies are viable for 10 years when stored at -20C, for 1 year when stored at 4C.

Please note that we recommend storing the antibodies at 4C for 1-2 weeks only. Some antibodies are prone to degrada...

Read More

Thank you for contacting Abcam regarding this.

Unfortunately because this information is considered proprietary, I am not able to share the exact contents of the standard/sample diluent other than to tell you it is an animal serum with 0.09%...

Read More

Thank you for your patience while I looked into your question. I have heard back from the lab, and ab106310 is also only the extracellular domain of VEGF receptor 2, and is thus not suitable for kinase studies. However, ab42614 has been tested ...

Read More

Thank you for contacting us with your question. Ab54347 is composed of the 7 extracellular ligand binding domains, and it does not contain the intracellular tyrosine kinase domain. So, this protein would not be suitable for kinase assays. We have...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"