Overview

  • Product nameAnti-ACTR10 antibody
    See all ACTR10 primary antibodies
  • Description
    Rabbit polyclonal to ACTR10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 287-336 (

    SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL

    ) of Human ACTR10 (NP_060947).

  • Positive control
    • 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceACTR10 (Actin related protein 10 homolog) belongs to the actin family.
  • Cellular localizationCytoplasm, cytoskeleton.
  • Database links
  • Alternative names
    • Actin related protein 10 antibody
    • Actin related protein 10 homolog (S. cerevisiae) antibody
    • Actin related protein 10 homolog antibody
    • ACTR 10 antibody
    • ACTR 11 antibody
    • ACTR11 antibody
    • ARP11 antibody
    • HARP 11 antibody
    • HARP11 antibody
    • Uncharacterized hypothalamus protein HARP11 antibody
    see all

Anti-ACTR10 antibody images

  • Anti-ACTR10 antibody (ab99148) at 1 µg/ml + 293T Cell Lysate at 10 µg

    Predicted band size : 46 kDa

References for Anti-ACTR10 antibody (ab99148)

ab99148 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Loading amount 20 µg
Gel Running Conditions Reduced Denaturing (4-12 Bis tris)
Sample Human Cell lysate - whole cell (293T)
Specification 293T
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 18°C
Username

Abcam user community

Verified customer

Submitted May 14 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"