Overview

  • Product name
  • Description
    Rabbit polyclonal to ADAD2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 359-408 (

    GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP

    ) of Human ADAD2 (NP_631913).

  • Positive control
    • Human Liver Cell Lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab105956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 62 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similarities
    Belongs to the ADAD family.
    Contains 1 A to I editase domain.
    Contains 1 DRBM (double-stranded RNA-binding) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Adad2 antibody
    • ADAD2_HUMAN antibody
    • Adenosine deaminase domain containing 2 antibody
    • Adenosine deaminase domain-containing protein 2 antibody
    • FLJ00337 antibody
    • TENRL antibody
    • Testis nuclear RNA-binding protein-like antibody
    see all

Anti-ADAD2 antibody images

  • Anti-ADAD2 antibody (ab105956) at 0.5 µg/ml + Human Liver Cell Lysate at 10 µg

    Predicted band size : 62 kDa

References for Anti-ADAD2 antibody (ab105956)

ab105956 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up