
  • Product nameAnti-ADAR1 antibody
    See all ADAR1 primary antibodies
  • Description
    Sheep polyclonal to ADAR1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Fusion protein: SFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEK NFYLCPVPND, corresponding to amino acids 1116-1176 of Rat ADAR1. The fusion protein was constructed in the pGEX-KG vector by inserting a fragment corresponding to nucleotides +3346 through +3525 of ADAR1 at the XbaI and XhoI sites in the vector.



Our Abpromise guarantee covers the use of ab16138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 136 kDa.


  • FunctionConverts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site-selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression.
  • Tissue specificityUbiquitously expressed, highest levels were found in brain and lung.
  • Involvement in diseaseDefects in ADAR are a cause of dyschromatosis symmetrical hereditaria (DSH) [MIM:127400]; also known as reticulate acropigmentation of Dohi. DSH is a pigmentary genodermatosis of autosomal dominant inheritance characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the dorsal parts of the hands and feet.
  • Sequence similaritiesContains 1 A to I editase domain.
    Contains 2 DRADA repeats.
    Contains 3 DRBM (double-stranded RNA-binding) domains.
  • Post-translational
    Sumoylation reduces RNA-editing activity.
  • Cellular localizationCytoplasm. Nucleus > nucleolus. Isoform 1 is found predominantly in cytoplasm but appears to shuttle between the cytoplasm and nucleus. Isoform 5 is found exclusively in the nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 136 kDa double-stranded RNA-binding protein antibody
    • 136kDa double stranded RNA binding protein antibody
    • Adar 1 antibody
    • ADAR antibody
    • Adar1 antibody
    • Adenosine deaminase acting on RNA 1 A antibody
    • Adenosine deaminase RNA specific 1 antibody
    • Adenosine deaminase RNA specific antibody
    • Adenosine deaminase that act on RNA antibody
    • AGS6 antibody
    • AV242451 antibody
    • Double stranded RNA specific adenosine deaminase antibody
    • Double-stranded RNA-specific adenosine deaminase antibody
    • Double-stranded RNA-specific editase Adar antibody
    • DRADA antibody
    • Dsh antibody
    • Dsrad antibody
    • DSRAD_HUMAN antibody
    • dsRNA adenosine deaminase antibody
    • EC 3.5.4.- antibody
    • G1P1 antibody
    • IFI 4 antibody
    • IFI-4 antibody
    • IFI4 antibody
    • Ifi4 protein antibody
    • Interferon induced protein 4 antibody
    • Interferon inducible protein 4 antibody
    • Interferon-inducible protein 4 antibody
    • K88DSRBP antibody
    • mZaADAR antibody
    • P136 antibody
    • Pre-mRNA adenosine deaminase antibody
    • RNA adenosine deaminase 1 antibody
    • RNA-editing deaminase 1 antibody
    • RNA-editing enzyme 1 antibody
    see all

References for Anti-ADAR1 antibody (ab16138)

ab16138 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab16138.
Please use the links above to contact us or submit feedback about this product.