Overview

  • Product name
    Anti-ADI1 antibody [AT27E8]
    See all ADI1 primary antibodies
  • Description
    Mouse monoclonal [AT27E8] to ADI1
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Cow, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human ADI1 aa 1-179. Purified from E. coli. NP_060739.1.
    Sequence:

    MVLAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDP ELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILD GSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFV GEPVWTAYNRPADHFEARGQYVKFLAQTA


    Database link: Q9BV57

  • Positive control
    • HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab175974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 21 kDa.
ELISA 1/1000.

Target

  • Function
    Has aci-reductone dioxygenase (ARD) activity and can function in the 5-methylthioadenosine (MTA) methionine salvage pathway. Down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line.
  • Tissue specificity
    Detected in heart, colon, lung, stomach, brain, spleen, liver, skeletal muscle and kidney.
  • Pathway
    Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 5/6.
  • Sequence similarities
    Belongs to the acireductone dioxygenase (ARD) family.
  • Cellular localization
    Cell membrane. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1 2 dihydroxy 3 keto 5 methylthiopentene dioxygenase antibody
    • 1 antibody
    • 2-dihydroxy-3-keto-5-methylthiopentene dioxygenase antibody
    • Aci reductone dioxygenase antibody
    • Acireductone dioxygenase (Fe(2+) requiring) antibody
    • Acireductone dioxygenase (Ni(2+) requiring) antibody
    • Acireductone dioxygenase (Ni(2+)-requiring) antibody
    • Acireductone dioxygenase 1 antibody
    • ADI 1 antibody
    • Adi1 antibody
    • ADI1 antibody antibody
    • APL1 antibody
    • ARD antibody
    • EC 1.13. antibody
    • Fe ARD antibody
    • FLJ10913 antibody
    • HMFT1638 antibody
    • Membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1 antibody
    • Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1 antibody
    • MT1 MMP cytoplasmic tail binding protein 1 antibody
    • MTCBP 1 antibody
    • MTCBP-1 antibody
    • MTCBP1 antibody
    • MTND_HUMAN antibody
    • Ni-ARD antibody
    • SIPL antibody
    • Submergence induced protein 2 antibody
    • Submergence induced protein 2 homolog antibody
    • Submergence induced protein like factor antibody
    • Submergence-induced protein 2 homolog antibody
    see all

Images

  • Lane 1 : Anti-ADI1 antibody [AT27E8] (ab175974) at 1/500 dilution
    Lane 2 : Anti-ADI1 antibody [AT27E8] (ab175974) at 1/1000 dilution
    Lane 3 : Anti-ADI1 antibody [AT27E8] (ab175974) at 1/5000 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : HepG2 cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    Goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 21 kDa

References

ab175974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up