Anti-AGAP8 antibody - C-terminal (ab192218)

Overview

  • Product name
    Anti-AGAP8 antibody - C-terminal
  • Description
    Rabbit polyclonal to AGAP8 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human AGAP8 aa 498-531 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    LDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKP


    Database link: Q5SRD3

  • Positive control
    • HT-1080 cell line lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab192218 was purified through a protein A column, followed by peptide affinity purification.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 73 kDa.

Target

  • Function
    Putative GTPase-activating protein.
  • Sequence similarities
    Belongs to the centaurin gamma-like family.
    Contains 2 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 PH domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • AGAP 8 antibody
    • AGAP-8 antibody
    • AGAP8 antibody
    • AGAP8_HUMAN antibody
    • Arf GAP with GTPase ANK repeat and PH domain containing protein 8 antibody
    • Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 8 antibody
    • ArfGAP with GTPase domain, ankyrin repeat and PH domain 8 antibody
    • Centaurin gamma like family member 5 antibody
    • Centaurin-gamma-like family member 5 antibody
    • CTGLF5 antibody
    see all

Images

  • Anti-AGAP8 antibody - C-terminal (ab192218) at 1/1000 dilution + HT-1080 cell line lysate at 35 µg

    Secondary
    Goat anti-rabbit IgG H&L(HRP) at 1/5000 dilution

    Predicted band size: 73 kDa

References

ab192218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up