Overview

  • Product name
    Anti-AK6 antibody
  • Description
    Rabbit polyclonal to AK6
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human AK6 aa 1-172.
    Sequence:

    MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEE YDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTN VLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPE ELENNVDQILKWIEQWIKDHNS


    Database link: Q9Y3D8

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab192653 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192653 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 20 kDa.

Target

  • Function
    Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulation of Cajal body (CB) formation.
  • Sequence similarities
    Belongs to the adenylate kinase family. AK6 subfamily.
  • Cellular localization
    Nucleus > nucleoplasm. Nucleus > Cajal body. Displays widespread diffuse nucleoplasmic distribution but not detected in nucleoli. Detected in Cajal bodies but not in all cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • AD-004 antibody
    • Adenylate kinase isoenzyme 6 antibody
    • Adrenal gland protein AD-004 antibody
    • AK/ATPase antibody
    • AK6 antibody
    • CGI-137 antibody
    • CIP antibody
    • Coilin-interacting nuclear ATPase protein antibody
    • Dual activity adenylate kinase/ATPase antibody
    • hCINAP antibody
    • KAD6_HUMAN antibody
    • TAF9 antibody
    see all

References

ab192653 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192653.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up