Overview

  • Product name
  • Description
    Rabbit polyclonal to AKIP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human AKIP aa 1-199. The identity of the protein fusion partner is GST. AAH62333.1.
    Sequence:

    MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAAS LPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQS YQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKT RFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK


    Database link: Q9NWT8

  • Positive control
    • Human testis tissue lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab199119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.

Target

  • Function
    May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.
  • Tissue specificity
    Ubiquitously expressed and especially highly expressed in heart, skeletal muscle and testis.
  • Cellular localization
    Mitochondrion. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 28S ribosomal protein S38 antibody
    • AIP antibody
    • AKIP_HUMAN antibody
    • AURKA interacting protein antibody
    • AURKA-interacting protein antibody
    • AURKAIP 1 antibody
    • Aurkaip1 antibody
    • Aurora A kinase interacting protein antibody
    • Aurora kinase A interacting protein 1 antibody
    • Aurora kinase A-interacting protein antibody
    • FLJ20608 antibody
    • mitochondrial antibody
    • MRP-S38 antibody
    see all

Images

  • Anti-AKIP antibody (ab199119) at 1/600 dilution + Human testis tissue at 40 µg

    Developed using the ECL technique.

    Predicted band size: 22 kDa


    Exposure time: 1 minute


    Gel: 10% SDS-PAGE

References

ab199119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up