Overview

  • Product name
  • Description
    Rabbit polyclonal to AKIP
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human AKIP aa 150-199 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK


    Database link: Q9NWT8

  • Positive control
    • Rat testis tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function
    May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.
  • Tissue specificity
    Ubiquitously expressed and especially highly expressed in heart, skeletal muscle and testis.
  • Cellular localization
    Mitochondrion. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 28S ribosomal protein S38 antibody
    • AIP antibody
    • AKIP_HUMAN antibody
    • AURKA interacting protein antibody
    • AURKA-interacting protein antibody
    • AURKAIP 1 antibody
    • Aurkaip1 antibody
    • Aurora A kinase interacting protein antibody
    • Aurora kinase A interacting protein 1 antibody
    • Aurora kinase A-interacting protein antibody
    • FLJ20608 antibody
    • mitochondrial antibody
    • MRP-S38 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat testis tissue labeling AKIP with ab214312 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up