Overview

  • Product name
  • Description
    Rabbit polyclonal to AKR1A1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human AKR1A1 aa 1-325.
    Sequence:

    MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIY GNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLA DLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEAL VAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHC QARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILL RWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV PMLTVDGKRVPRDAGHPLYPFNDPY


    Database link: P14550

  • Positive control
    • Y79 and Jurkat cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.

Target

  • Function
    Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. In vitro substrates include succinic semialdehyde, 4-nitrobenzaldehyde, 1,2-naphthoquinone, methylglyoxal, and D-glucuronic acid. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs, including the anthracyclines doxorubicin (DOX) and daunorubicin (DAUN).
  • Tissue specificity
    Widely expressed. Highly expressed in kidney, salivary gland and liver. Detected in trachea, stomach, brain, lung, prostate, placenta, mammary gland, small intestine and lung.
  • Sequence similarities
    Belongs to the aldo/keto reductase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • AK1A1_HUMAN antibody
    • Akr1a1 antibody
    • Alcohol dehydrogenase [NADP+] antibody
    • Alcohol dehydrogenase antibody
    • Aldehyde reductase antibody
    • Aldo keto reductase family 1 member A1 (aldehyde reductase) antibody
    • Aldo-keto reductase family 1 member A1 antibody
    • ALDR1 antibody
    • ALR antibody
    • ARM antibody
    • DD3 antibody
    • MGC12529 antibody
    • MGC1380 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human thyroid cancer tissue labelling AKR1A1 with ab175258 at 1/400. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human endometrial cancer tissue labelling AKR1A1 with ab175258 at 1/400. Magnification: 200x.
  • All lanes : Anti-AKR1A1 antibody (ab175258) at 1/500 dilution

    Lane 1 : Y79 cell lysate
    Lane 2 : Jurkat cell lysate

    Predicted band size: 37 kDa

References

ab175258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up