Overview

  • Product name
    Anti-Alcohol Dehydrogenase antibody
    See all Alcohol Dehydrogenase primary antibodies
  • Description
    Rabbit polyclonal to Alcohol Dehydrogenase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Alcohol Dehydrogenase aa 110-159 (N terminal).
    Sequence:

    NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA

  • Positive control
    • Fetal liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab80354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 40 kDa (predicted molecular weight: 40 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/12500.

Target

Images

  • Anti-Alcohol Dehydrogenase antibody (ab80354) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 40 kDa
    Observed band size: 40 kDa



    Gel concentration: 12%

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up