Overview

  • Product nameAnti-ALDH1B1 antibody
    See all ALDH1B1 primary antibodies
  • Description
    Rabbit polyclonal to ALDH1B1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 396 - 445 (

    FFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLA

    ) of Human ALDH1B1 (NP_000683)

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
  • Tissue specificityLiver, testis and to a lesser extent in brain.
  • PathwayAlcohol metabolism; ethanol degradation; acetate from ethanol: step 2/2.
  • Sequence similaritiesBelongs to the aldehyde dehydrogenase family.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • Acetaldehyde dehydrogenase 5 antibody
    • AL1B1_HUMAN antibody
    • Aldehyde dehydrogenase 1 family, member B1 antibody
    • Aldehyde dehydrogenase 1B1 antibody
    • Aldehyde dehydrogenase 5 antibody
    • Aldehyde dehydrogenase family 1 member B1 antibody
    • Aldehyde dehydrogenase X antibody
    • Aldehyde dehydrogenase X mitochondrial antibody
    • ALDH class 2 antibody
    • Aldh1b1 antibody
    • ALDH5 antibody
    • ALDHX antibody
    • MGC2230 antibody
    • Mitochondrial aldehyde dehydrogenase X antibody
    • mitochondrial antibody
    • OTTHUMP00000021399 antibody
    see all

Anti-ALDH1B1 antibody images

  • Anti-ALDH1B1 antibody (ab86382) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 57 kDa

References for Anti-ALDH1B1 antibody (ab86382)

ab86382 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"