Overview

  • Product name
  • Description
    Mouse polyclonal to ALOX12B
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human ALOX12B aa 171-261. NP_001130
    Sequence:

    NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALA FKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAED


    Database link: O75342

  • Positive control
    • Jurkat cell lysate; recombinant immunogen

Properties

Applications

Our Abpromise guarantee covers the use of ab194481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 80 kDa.

This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein

Target

  • Function
    Converts arachidonic acid to 12R-hydroperoxyeicosatetraenoic acid (12R-HPETE).
  • Tissue specificity
    Expressed in B-cells, hair follicles, foreskin keratinocytes and adult skin. Also expressed in psoriatic tissue.
  • Pathway
    Lipid metabolism; leukotriene D4 biosynthesis.
  • Involvement in disease
    Defects in ALOX12B are a cause of non-bullous congenital ichthyosiform erythroderma (NCIE) [MIM:242100]. NCIE is a non-bullous ichthyosis, a skin disorder characterized by abnormal cornification of the epidermis. Most affected individuals are born with a tight, shiny, translucent covering called collodion membrane. The collodion membrane subsequently evolves into generalized scaling and intense redness of the skin. Clinical features are milder than in lamellar ichthyoses and demonstrate a greater variability in the intensity of erythema, size and type of scales. In contrast to lamellar ichthyoses, scales are usually white, fine and powdery, and palms and soles are severely affected. Patients suffer from palmoplantar keratoderma, often with painful fissures, digital contractures, and loss of pulp volume.
  • Sequence similarities
    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 12R-lipoxygenase antibody
    • 12R-LOX antibody
    • 12R-type antibody
    • Alox12b antibody
    • Arachidonate 12-lipoxygenase antibody
    • Epidermis-type lipoxygenase 12 antibody
    • LX12B_HUMAN antibody
    see all

Images

  • Anti-ALOX12B antibody (ab194481) at 1/500 dilution + Jurkat cell lysate at 50 µg

    Predicted band size : 80 kDa
  • Anti-ALOX12B antibody (ab194481) at 1/1000 dilution + Recombinant protein corresponding to immunogen at 0.2 µg

    Predicted band size : 80 kDa

References

ab194481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up