You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

alpha 1 Glycine Receptor protein (Tagged) (ab114750)

Submit an Abreview Submit a Question

Overview

  • Product namealpha 1 Glycine Receptor protein (Tagged)See all alpha 1 Glycine Receptor proteins and peptides ...
  • Protein descriptionRecombinant fragment of Human alpha 1 Glycine Receptor (amino acids 121-220) with N terminal proprietary tag, 36.63kDa. (NP_000162).
  • Uniprot accessionP23415
  • Molecular weight36.630kDa inclusive of tags
  • Protein length100 amino acids
  • Expression hostWheat germ

    • Properties

  • FormLiquid
  • Storage instructionsShipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl
  • Concentration information loading...
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • SequenceIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRI TLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQE QGAVQVADGLTLPQFILKEE
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab114750 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    ELISA ELISA: Use at an assay dependent concentration.
    SDS-PAGE SDS-PAGE: Use at an assay dependent concentration.
    WB WB: Use at an assay dependent concentration. Recombinant protein

    Protein info

    • Alternative names
        GLRA1GLRA1_HUMANGlycine receptor 48 kDa subunit
        Glycine receptor alpha 1Glycine receptor strychnine-binding subunitGlycine receptor subunit alpha-1Glycine receptor, alpha 1 subunitHKPX1STHE
      see all
  • FunctionThe glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).
  • Involvement in diseaseDefects in GLRA1 are a cause of startle disease (STHE) [MIM:149400]; also known as hereditary hyperekplexia or congenital stiff-person syndrome. STHE is a genetically heterogeneous neurologic disorder characterized by muscular rigidity of central nervous system origin, particularly in the neonatal period, and by an exaggerated startle response to unexpected acoustic or tactile stimuli. Inheritance can be autosomal dominant or recessive.
  • Sequence similaritiesBelongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA1 sub-subfamily.
  • Cellular localizationCell junction > synapse > postsynaptic cell membrane. Cell membrane.

    • Target information above from: UniProt accession P23415 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    alpha 1 Glycine Receptor protein (Tagged) images

    • SDS-PAGE - alpha 1 Glycine Receptor protein (ab114750)
      SDS-PAGE - alpha 1 Glycine Receptor protein (ab114750)
      12.5% SDS-PAGE Stained with Coomassie Blue showing ab114750 at approximately 36.63kDa.

    References for alpha 1 Glycine Receptor protein (Tagged) (ab114750)

    ab114750 has not yet been referenced specifically in any publications.

    Publishing research using ab114750 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab114750 Submit a Question for ab114750

    There are currently no Abreviews or Questions for ab114750.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"