Anti-alpha 1 Spectrin antibody - N-terminal (ab186886)

Overview

  • Product name
    Anti-alpha 1 Spectrin antibody - N-terminal
    See all alpha 1 Spectrin primary antibodies
  • Description
    Rabbit polyclonal to alpha 1 Spectrin - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human alpha 1 Spectrin aa 380-429 (N terminal). The exact sequence is proprietary.
    Sequence:

    DELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSA


    Database link: P02549

  • Positive control
    • Human fetal liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab186886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 280 kDa.

Target

  • Function
    Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane.
  • Involvement in disease
    Defects in SPTA1 are the cause of elliptocytosis type 2 (EL2) [MIM:130600]. EL2 is a Rhesus-unlinked form of hereditary elliptocytosis, a genetically heterogeneous, autosomal dominant hematologic disorder. It is characterized by variable hemolytic anemia and elliptical or oval red cell shape.
    Defects in SPTA1 are a cause of hereditary pyropoikilocytosis (HPP) [MIM:266140]. HPP is an autosomal recessive disorder characterized by hemolytic anemia, microspherocytosis, poikilocytosis, and an unusual thermal sensitivity of red cells.
    Defects in SPTA1 are the cause of spherocytosis type 3 (SPH3) [MIM:270970]; also known as hereditary spherocytosis type 3 (HS3). Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. SPH3 is characterized by severe hemolytic anemia. Inheritance is autosomal recessive.
  • Sequence similarities
    Belongs to the spectrin family.
    Contains 3 EF-hand domains.
    Contains 1 SH3 domain.
    Contains 21 spectrin repeats.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasm > cell cortex.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha I spectrin antibody
    • EL 2 antibody
    • EL2 antibody
    • Elliptocytosis 2 antibody
    • Elliptocytosis2 antibody
    • Erythrocyte alpha spectrin antibody
    • erythrocyte antibody
    • Erythroid alpha spectrin antibody
    • Erythroid alpha-spectrin antibody
    • Erythroid spectrin alpha antibody
    • HPP antibody
    • HS3 antibody
    • Spectrin alpha chain antibody
    • Spectrin alpha chain erythrocyte antibody
    • Spectrin alpha erythrocytic 1 antibody
    • SPH3 antibody
    • SPTA 1 antibody
    • SPTA antibody
    • SPTA1 antibody
    • SPTA1_HUMAN antibody
    see all

Images

  • Anti-alpha 1 Spectrin antibody - N-terminal (ab186886) at 1 µg/ml + Human fetal liver tissue lysate at 10 µg

    Predicted band size : 280 kDa

References

ab186886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up