Anti-alpha Synuclein antibody [2B2D1 + 2B2A11] (ab36615)


  • Product nameAnti-alpha Synuclein antibody [2B2D1 + 2B2A11]
    See all alpha Synuclein primary antibodies
  • Description
    Mouse monoclonal [2B2D1 + 2B2A11] to alpha Synuclein
  • Tested applicationsSuitable for: WB, IHC-P, IHC-Fr, ELISAmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Ni-NTA purified truncated recombinant human alpha Synuclein expressed in E. Coli strain BL21 (DE3).

  • Positive control
    • Human glioma tissue.



Our Abpromise guarantee covers the use of ab36615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 15 kDa.
IHC-P Use at an assay dependent dilution.
IHC-Fr 1/500 - 1/2000.
ELISA 1/10000.


  • FunctionMay be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.
  • Tissue specificityExpressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.
  • Involvement in diseaseGenetic alterations of SNCA resulting in aberrant polymerization into fibrils, are associated with several neurodegenerative diseases (synucleinopathies). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimer disease amyloid plaque, and a major component of Lewy body inclusions. They are also found within Lewy body (LB)-like intraneuronal inclusions, glial inclusions and axonal spheroids in neurodegeneration with brain iron accumulation type 1.
    Parkinson disease 1
    Parkinson disease 4
    Dementia Lewy body
  • Sequence similaritiesBelongs to the synuclein family.
  • DomainThe 'non A-beta component of Alzheimer disease amyloid plaque' domain (NAC domain) is involved in fibrils formation. The middle hydrophobic region forms the core of the filaments. The C-terminus may regulate aggregation and determine the diameter of the filaments.
  • Post-translational
    Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.
    Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.
    Ubiquitinated. The predominant conjugate is the diubiquitinated form.
    Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.
  • Cellular localizationCytoplasm, cytosol. Membrane. Nucleus. Cell junction, synapse. Secreted. Membrane-bound in dopaminergic neurons.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha synuclein antibody
    • Alpha-synuclein antibody
    • Alpha-synuclein, isoform NACP140 antibody
    • alphaSYN antibody
    • MGC105443 antibody
    • MGC110988 antibody
    • MGC127560 antibody
    • MGC64356 antibody
    • NACP antibody
    • Non A beta component of AD amyloid antibody
    • Non A4 component of amyloid antibody
    • Non A4 component of amyloid precursor antibody
    • Non-A beta component of AD amyloid antibody
    • Non-A-beta component of alzheimers disease amyloid , precursor of antibody
    • Non-A4 component of amyloid precursor antibody
    • Non-A4 component of amyloid, precursor of antibody
    • OTTHUMP00000218549 antibody
    • OTTHUMP00000218551 antibody
    • OTTHUMP00000218552 antibody
    • OTTHUMP00000218553 antibody
    • OTTHUMP00000218554 antibody
    • PARK 1 antibody
    • PARK 4 antibody
    • PARK1 antibody
    • PARK4 antibody
    • Parkinson disease (autosomal dominant, Lewy body) 4 antibody
    • Parkinson disease familial 1 antibody
    • PD 1 antibody
    • PD1 antibody
    • SNCA antibody
    • Snca synuclein, alpha (non A4 component of amyloid precursor) antibody
    • SYN antibody
    • Synuclein alpha antibody
    • Synuclein alpha 140 antibody
    • Synuclein, alpha (non A4 component of amyloid precursor) antibody
    • SYUA_HUMAN antibody
    see all

Anti-alpha Synuclein antibody [2B2D1 + 2B2A11] images

  • All lanes : Anti-alpha Synuclein antibody [2B2D1 + 2B2A11] (ab36615)

    Lane 1 : Molecular weight marker
    Lane 2 : Recombinant human alpha Synuclein protein (NB:truncated form)

    Predicted band size : 15 kDa
  • Immunohistochemical analysis of paraffin-embedded human glioma tissue, showing membrane localisation using anti-human alpha Synuclein antibody (ab36615) dilution range 1:500-1:2000 and an HRP-conjugated secondary antibody with DAB staining.

References for Anti-alpha Synuclein antibody [2B2D1 + 2B2A11] (ab36615)

This product has been referenced in:
  • Petit GH  et al. Rasagiline ameliorates olfactory deficits in an alpha-synuclein mouse model of Parkinson's disease. PLoS One 8:e60691 (2013). IHC-P ; Mouse . Read more (PubMed: 23573275) »
  • Mulcahy P  et al. Development and characterisation of a novel rat model of Parkinson's disease induced by sequential intranigral administration of AAV-a-synuclein and the pesticide, rotenone. Neuroscience 203:170-9 (2012). Read more (PubMed: 22198020) »

See all 2 Publications for this product

Product Wall

Thank you for contacting us.

The antibody ab36615 has only been tested with human samples we do not have any rat related data so I am sorry we are unable to confirm, whether this antibody would react with rat sections or not. Also the immunoge...

Read More

We have determined that there will not be a new lot in the near future, and that the latest two vials you received (on orders from January 2012 and December 2010) were from the same lot. So there is a possibility that the defect is confined to a single...

Read More

Thank you for confirming these details and for your cooperation.

Having reviewed our previous conversation, it seems that you have not been issued a credit note yet. This is usually a number which starts with the letters CGB and would have be...

Read More

A new lot will not be available for at least six months, given estions.the inventory we have in stock and the anticipated sales.

There is one interesting alternative, the sheep polyclonal ab6162. The datasheet includes an image of a transgen...

Read More

Thank you for your enquiry. I am sorry to hear you have had trouble with this new lot of ab36615. We have had one other complaint of a similar nature from this antibody recently. At this time however we only have this same lot in stock as we have sold ...

Read More

Thank you for contacting us with your question. Neither of these antibodies has been tested for cross-reactivity with mouse or rat samples. I aligned the immunogen sequences with the rat and mouse alpha synucleins, and there is 95% identity among al...

Read More

Thank you for your patience in this matter. The originator of ab36615 has provided the truncated protein sequence that was used to raise this antibody: DVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATG...

Read More