Overview

  • Product nameAnti-ALPPL2 antibody
    See all ALPPL2 primary antibodies
  • Description
    Rabbit polyclonal to ALPPL2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chicken, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 431-480 (

    SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV

    ) of human ALPPL2 (NP_112603).

  • Positive control
    • OVCAR-3 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificityTrace amounts in the testis and thymus, and in elevated amounts in germ cell tumors.
  • Sequence similaritiesBelongs to the alkaline phosphatase family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Akp5 antibody
    • Alkaline phosphatase antibody
    • Alkaline phosphatase Nagao isozyme antibody
    • Alkaline phosphatase placental like antibody
    • ALP 1 antibody
    • ALP-1 antibody
    • ALP1 antibody
    • ALPG antibody
    • ALPPL 2 antibody
    • ALPPL antibody
    • ALPPL2 antibody
    • C77216 antibody
    • D1Ertd816e antibody
    • GCAP antibody
    • Germ cell alkaline phosphatase antibody
    • Nagao isozyme antibody
    • Placental alkaline phosphatase-like antibody
    • Placental like alkaline phosphatase antibody
    • placental-like antibody
    • PLAP like antibody
    • PLAP-like antibody
    • PPBN_HUMAN antibody
    • Testicular and thymus alkaline phosphatase antibody
    see all

Anti-ALPPL2 antibody images

  • Anti-ALPPL2 antibody (ab99177) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    Secondary
    Goat Anti-Rabbit IgG Antibody (HRP-Conjugated)

    Predicted band size : 57 kDa

References for Anti-ALPPL2 antibody (ab99177)

ab99177 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"