Overview

  • Product nameAnti-ALS2CR12 antibody
    See all ALS2CR12 primary antibodies
  • Description
    Rabbit polyclonal to ALS2CR12
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the N-terminal amino acids 35-84 (

    SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP

    )of Human ALS2CR12 (NP_631902)

  • Positive control
    • MCF7 cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1/62500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe exact function of ALS2CR12 remains unknown.
  • Database links
  • Alternative names
    • ALS2CR12 antibody
    • Amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 antibody
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein antibody

Anti-ALS2CR12 antibody images

  • Anti-ALS2CR12 antibody (ab83040) at 1 µg/ml (HRP conjugated anti-Rabbit IgG ) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa
    Observed band size : 52 kDa

References for Anti-ALS2CR12 antibody (ab83040)

ab83040 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"