Overview

  • Product name
    Anti-AMH antibody [5/6]
    See all AMH primary antibodies
  • Description
    Mouse monoclonal [5/6] to AMH
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Sheep, Human, Baboon
    Predicted to work with: Rat, Cow, Pig
  • Immunogen

    Synthetic peptide:

    VPTAYAGKLLISLSEERISAHHVPNMVATEC

    , corresponding to C terminal amino acids 527-557 of Human AMH.

  • Positive control
    • Mouse ovary tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab24542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/40. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.
  • Cellular localization
    Secreted
  • Database links
  • Alternative names
    • Anti muellerian hormone antibody
    • MIF antibody
    • MIS antibody
    • Muellerian inhibiting factor antibody
    • Mullerian inhibiting substance antibody
    see all

Anti-AMH antibody [5/6] images

  • Ab24542, at a dilution of 1/20 to 1/40, staining formalin fixed paraffin embedded ovary tissue from a 25 day old mouse by Immunohystochemistry.

References for Anti-AMH antibody [5/6] (ab24542)

This product has been referenced in:
  • Satie AP  et al. Excess type I interferon signaling in the mouse seminiferous tubules leads to germ cell loss and sterility. J Biol Chem 286:23280-95 (2011). IHC-P ; Mouse . Read more (PubMed: 21515676) »
  • Kevenaar ME  et al. Serum anti-mullerian hormone levels reflect the size of the primordial follicle pool in mice. Endocrinology 147:3228-34 (2006). Read more (PubMed: 16556768) »

See all 4 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab24542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up