Overview

  • Product nameAnti-AMPD2 antibody
    See all AMPD2 primary antibodies
  • Description
    Mouse monoclonal to AMPD2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment with tag:

    ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLE REFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT

    corresponding to amino acids 86-186 of Human AMPD2

Properties

Applications

Our Abpromise guarantee covers the use of ab54791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
  • Application notesWB: Use at a concentration of 1-5 µg/ml.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionAMP deaminase plays a critical role in energy metabolism.
    • Tissue specificityThree isoforms are present in mammals: AMP deaminase 1 is the predominant form in skeletal muscle; AMP deaminase 2 predominates in smooth muscle, non-muscle tissue, embryonic muscle and undifferentiated myoblasts; AMP deaminase 3 is found in erythrocytes.
    • PathwayPurine metabolism; IMP biosynthesis via salvage pathway; IMP from AMP: step 1/1.
    • Sequence similaritiesBelongs to the adenosine and AMP deaminases family.
    • Information by UniProt
    • Database links
    • Alternative names
      • Adenosine monophosphate deaminase 2 (isoform L) antibody
      • Adenosine monophosphate deaminase 2 antibody
      • adenosine monophosphate deaminase 2 isoform L antibody
      • AMP deaminase 2 antibody
      • AMP deaminase isoform L antibody
      • AMPD 2 antibody
      • AMPD antibody
      • AMPD2 antibody
      • AMPD2_HUMAN antibody
      • RP5-1160K1.5 antibody
      • SPG63 antibody
      see all

    Anti-AMPD2 antibody images



    • Predicted band size : 101 kDa

    References for Anti-AMPD2 antibody (ab54791)

    ab54791 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab54791.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"