Anti-AMPK beta 2 antibody [MM0963-7T21] (ab211668)

Overview

  • Product name
    Anti-AMPK beta 2 antibody [MM0963-7T21]
    See all AMPK beta 2 primary antibodies
  • Description
    Rat monoclonal [MM0963-7T21] to AMPK beta 2
  • Host species
    Rat
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Human AMPK beta 2 aa 1-272.
    Sequence:

    MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPD SKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWS TKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTIN NLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEE RFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSV MVLSATHRYKKKYVTTLLYKPI


    Database link: O43741

  • Positive control
    • Human lung carcinoma cell line lysate.

Applications

Our Abpromise guarantee covers the use of ab211668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 30 kDa.

Target

  • Function
    AMPK is responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. Also regulates cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase and hormone-sensitive lipase. This is a regulatory subunit, may be a positive regulator of AMPK activity. It may also serve as an adapter molecule for the catalytic alpha-subunit.
  • Sequence similarities
    Belongs to the 5'-AMP-activated protein kinase beta subunit family.
  • Post-translational
    modifications
    Phosphorylated when associated with the catalytic subunit.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5' AMP activated protein kinase beta 2 subunit antibody
    • 5' AMP activated protein kinase subunit beta 2 antibody
    • 5''-AMP-activated protein kinase subunit beta-2 antibody
    • AAKB2_HUMAN antibody
    • AMP activated protein kinase beta 2 non catalytic subunit antibody
    • AMPK beta 2 antibody
    • AMPK beta 2 chain antibody
    • AMPK subunit beta 2 antibody
    • AMPK subunit beta-2 antibody
    • MGC61468 antibody
    • PRKAB 2 antibody
    • Prkab2 antibody
    • Protein kinase AMP activated beta 2 non catalytic subunit antibody
    see all

Images

  • Anti-AMPK beta 2 antibody [MM0963-7T21] (ab211668) at 1/1000 dilution + Human lung carcinoma cell line lysate

    Predicted band size: 30 kDa

References

ab211668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up