Anti-Anaerobic ribonucleoside-triphosphate reductase antibody (FITC) (ab193429)

Overview

  • Product name
    Anti-Anaerobic ribonucleoside-triphosphate reductase antibody (FITC)
    See all Anaerobic ribonucleoside-triphosphate reductase primary antibodies
  • Description
    Rabbit polyclonal to Anaerobic ribonucleoside-triphosphate reductase (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Anaerobic ribonucleoside-triphosphate reductase aa 1-712.
    Sequence:

    MTPHVMKRDGCKVPFKSERIKEAILRAAKAAEVDDADYCATVAAVVSEQM QGRNQVDINEIQTAVENQLMSGPYKQLARAYIEYRHDRDIEREKRGRLNQ EIRGLVEQTNASLLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPRDV VQAHERGDIHYHDLDYSPFFPMFNCMLIDLKGMLTQGFKMGNAEIEPPKS ISTATAVTAQIIAQVASHIYGGTTINRIDEVLAPFVTASYNKHRKTAEEW NIPDAEGYANSRTIKECYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGTS WESRLIQESILRNRIAGLGKNRKTAVFPKLVFAIRDGLNHKKGDPNYDIK QLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVWENENGEQIH DGRNNLGVISLNLPRIALEAKGDEATFWKLLDERLVLARKALMTRIARLE GVKARVAPILYMEGACGVRLNADDDVSEIFKNGRASISLGYIGIHETINA LFGGEHVYDNEQLRAKGIAIVERLRQAVDQWKEETGYGFSLYSTPSENLC DRFCRLDTAEFGVVPGVTDKGYYTNSFHLDVEKKVNPYDKIDFEAPYPPL ANGGFICYGEYPNIQHNLKALEDVWDYSYQHVPYYGTNTPIDECYECGFT GEFECTSKGFTCPKCGNHDASRVSVTRRVCGYLGSPDARPFNAGKQEEVK RRVKHLGNGQIG


    Database link: P28903

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 80 kDa.

Target

  • Relevance
    Ribonucleotide reductase is an essential enzyme in all organisms. It provides precursors for DNA synthesis by reducing all four ribonucleotides to deoxyribonucleotides. The overall activity and the substrate specificity of RNR are allosterically regulated by deoxyribonucleoside triphosphates and ATP, thereby providing balanced dNTP pools. Catalytic activity: 2'-deoxyribonucleoside triphosphate + thioredoxin disulfide + H2O = ribonucleoside triphosphate + thioredoxin
  • Database links
    • Alternative names
      • ECK4233 antibody
      • JW4197 antibody

    References

    ab193429 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193429.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up