Anti-Angiopoietin 1 antibody (Biotin) (ab193397)

Overview

  • Product name
    Anti-Angiopoietin 1 antibody (Biotin)
    See all Angiopoietin 1 primary antibodies
  • Description
    Rabbit polyclonal to Angiopoietin 1 (Biotin)
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Cow
    Predicted to work with: Mouse, Rat, Dog, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Cow Angiopoietin 1 aa 24-148.
    Sequence:

    RSPENGGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRDAPH VEQDFSSQKLQHLEHVMENYTQWLQKIENYIVENMKSEMAQIQQNAVQNH TATMLEIGTSLLSQTAEQTRKLTDV


    Database link: O18920

Properties

Applications

Our Abpromise guarantee covers the use of ab193397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 57 kDa.
ELISA Use at an assay dependent concentration.

Target

References

ab193397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up