Overview

  • Product name
  • Description
    Rabbit polyclonal to ANKLE2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat
  • Immunogen

    Synthetic peptide corresponding to a region within the middle amino acids 864-913 (

    CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

    ) of Human ANKLE2 (NP_055929)

  • Positive control
    • 293T cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 104 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Involved in mitotic nuclear envelope reassembly by promoting dephosphorylation of BAF/BANF1 during mitotic exit. Coordinates the control of BAF/BANF1 dephosphorylation by inhibiting VRK1 kinase and promoting dephosphorylation of BAF/BANF1 by protein phosphatase 2A (PP2A), thereby facilitating nuclear envelope assembly. It is unclear whether it acts as a real PP2A regulatory subunit or whether it is involved in recruitment of the PP2A complex.
  • Sequence similarities
    Belongs to the ANKLE2 family.
    Contains 1 ANK repeat.
    Contains 1 LEM domain.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ANKL2_HUMAN antibody
    • ANKLE 2 antibody
    • ANKLE2 antibody
    • ankyrin repeat and LEM domain containing 2 antibody
    • Ankyrin repeat and LEM domain-containing protein 2 antibody
    • FLJ 22280 antibody
    • FLJ 36132 antibody
    • FLJ22280 antibody
    • FLJ36132 antibody
    • KIAA 0692 antibody
    • KIAA0692 antibody
    • LEM domain containing 7 antibody
    • LEM domain-containing protein 4 antibody
    • LEMD 7 antibody
    • LEMD7 antibody
    see all

Images

  • Anti-ANKLE2 antibody (ab83830) at 1 µg/ml (in 5% skim milk / PBS buffer) + 10ug 293T cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 104 kDa
    Observed band size: 115 kDa (why is the actual band size different from the predicted?)



    Gel concentration 6-18%

References

ab83830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up