Overview

  • Product nameAnti-ANKLE2 antibody
    See all ANKLE2 primary antibodies
  • Description
    Rabbit polyclonal to ANKLE2
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat
  • Immunogen

    Synthetic peptide corresponding to a region within the middle amino acids 864-913 (

    CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

    ) of Human ANKLE2 (NP_055929)

  • Positive control
    • 293T cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 104 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInvolved in mitotic nuclear envelope reassembly by promoting dephosphorylation of BAF/BANF1 during mitotic exit. Coordinates the control of BAF/BANF1 dephosphorylation by inhibiting VRK1 kinase and promoting dephosphorylation of BAF/BANF1 by protein phosphatase 2A (PP2A), thereby facilitating nuclear envelope assembly. It is unclear whether it acts as a real PP2A regulatory subunit or whether it is involved in recruitment of the PP2A complex.
  • Sequence similaritiesBelongs to the ANKLE2 family.
    Contains 1 ANK repeat.
    Contains 1 LEM domain.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ANKL2_HUMAN antibody
    • ANKLE 2 antibody
    • ANKLE2 antibody
    • ankyrin repeat and LEM domain containing 2 antibody
    • Ankyrin repeat and LEM domain-containing protein 2 antibody
    • FLJ 22280 antibody
    • FLJ 36132 antibody
    • FLJ22280 antibody
    • FLJ36132 antibody
    • KIAA 0692 antibody
    • KIAA0692 antibody
    • LEM domain containing 7 antibody
    • LEM domain-containing protein 4 antibody
    • LEMD 7 antibody
    • LEMD7 antibody
    see all

Anti-ANKLE2 antibody images

  • Anti-ANKLE2 antibody (ab83830) at 1 µg/ml (in 5% skim milk / PBS buffer) + 10ug 293T cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 104 kDa
    Observed band size : 115 kDa (why is the actual band size different from the predicted?)

References for Anti-ANKLE2 antibody (ab83830)

ab83830 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"