Overview

  • Product nameAnti-ANKRD50 antibody
    See all ANKRD50 primary antibodies
  • Description
    Rabbit polyclonal to ANKRD50
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 1146-1195 (

    LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT

    ) of Rat ANKRD50 (NP_001178535.1)

  • Positive control
    • Rat lung lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab125317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 156 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ANKRD50 antibody images

  • Anti-ANKRD50 antibody (ab125317) at 1 µg/ml + Rat lung lysate at 10 µg

    Predicted band size : 156 kDa

References for Anti-ANKRD50 antibody (ab125317)

ab125317 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"