Overview

  • Product nameAnti-ANKRD7 antibody
    See all ANKRD7 primary antibodies
  • Description
    Rabbit polyclonal to ANKRD7
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to an internal region within amino acids 109-158 (ILLNFGADPDLRDIRYNTVLHYAVCGQSLSLVEKLLEYEADLEAKNKDG Y) of Human ANKRD7, NP_001071176

  • Positive control
    • Placental lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

Target

Anti-ANKRD7 antibody images

  • Anti-ANKRD7 antibody (ab81309) at 1 µg/ml (in 5% skim milk / PBS buffer) + Placental lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa
    Observed band size : 29 kDa

References for Anti-ANKRD7 antibody (ab81309)

ab81309 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"