Overview

  • Product nameAnti-Annexin A11 antibody
    See all Annexin A11 primary antibodies
  • Description
    Rabbit polyclonal to Annexin A11
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 328-377(

    TSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKF )

    of Mouse Annexin A11 (NP_038497).

  • Positive control
    • Mouse pancreas lysates.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab116053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 54 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionBinds specifically to calcyclin in a calcium-dependent manner (By similarity). Required for midbody formation and completion of the terminal phase of cytokinesis.
  • Sequence similaritiesBelongs to the annexin family.
    Contains 4 annexin repeats.
  • DomainA pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Cellular localizationCytoplasm. Melanosome. Nucleus envelope. Nucleus > nucleoplasm. Cytoplasm > cytoskeleton > spindle. Found throughout the nucleoplasm at interphase and during mitosis concentrates around the mitotic apparatus (By similarity). Elevation of intracellular calcium causes relocalization from the nucleoplasm to the nuclear envelope, with little effect on the cytoplasmic pool. Localization to the nuclear envelope is cell-cycle dependent.
  • Information by UniProt
  • Database links
  • Alternative names
    • 56 kDa autoantigen antibody
    • Annexin A11 antibody
    • Annexin XI antibody
    • Annexin-11 antibody
    • AnnexinA11 antibody
    • AnnexinXI antibody
    • ANX 11 antibody
    • ANX A11 antibody
    • ANX11 antibody
    • ANX11_HUMAN antibody
    • ANXA 11 antibody
    • ANXA11 antibody
    • Autoantigen 56 kD antibody
    • Calcyclin associated annexin 50 antibody
    • Calcyclin-associated annexin 50 antibody
    • CAP 50 antibody
    • CAP-50 antibody
    • CAP50 antibody
    • OTTHUMP00000059806 antibody
    see all

Anti-Annexin A11 antibody images

  • Anti-Annexin A11 antibody (ab116053) at 1 µg/ml + mouse pancreas lysates at 10 µg

    Predicted band size : 54 kDa

References for Anti-Annexin A11 antibody (ab116053)

ab116053 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"