Overview

  • Product name
    Anti-Antithrombin III antibody
    See all Antithrombin III primary antibodies
  • Description
    Rabbit polyclonal to Antithrombin III
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Antithrombin III aa 33-185.
    Sequence:

    HGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWE LSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQ QLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDK SLT


    Database link: P01008

  • Positive control
    • U251 cell extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 52 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF Use at an assay dependent concentration.

Target

  • Function
    Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.
  • Tissue specificity
    Found in plasma.
  • Involvement in disease
    Defects in SERPINC1 are the cause of antithrombin III deficiency (AT3D) [MIM:613118]. AT3D is an important risk factor for hereditary thrombophilia, a hemostatic disorder characterized by a tendency to recurrent thrombosis. AT3D is classified into 4 types. Type I: characterized by a 50% decrease in antigenic and functional levels. Type II: has defects affecting the thrombin-binding domain. Type III: alteration of the heparin-binding domain. Plasma AT-III antigen levels are normal in type II and III. Type IV: consists of miscellaneous group of unclassifiable mutations.
  • Sequence similarities
    Belongs to the serpin family.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt
  • Database links
  • Alternative names
    • ANT3_HUMAN antibody
    • Antithrombin antibody
    • Antithrombin III antibody
    • Antithrombin-III antibody
    • AntithrombinIII antibody
    • AT 3 antibody
    • AT III antibody
    • AT3 antibody
    • AT3D antibody
    • ATIII antibody
    • Heparin cofactor I antibody
    • MGC22579 antibody
    • Serine (or cysteine) proteinase inhibitor clade C (antithrombin) member 1 antibody
    • Serine cysteine proteinase inhibitor clade C member 1 antibody
    • Serine proteinase inhibitor clade C member 1 antibody
    • Serpin C1 antibody
    • Serpin family C member 1 antibody
    • Serpin peptidase inhibitor clade C (antithrombin) member 1 antibody
    • SERPINC1 antibody
    • THPH7 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab180614. Blue DAPI for nuclear staining.
  • All lanes : Anti-Antithrombin III antibody (ab180614) at 1/500 dilution

    Lane 1 : U251 cell extract
    Lane 2 : HepG2 cell extract
    Lane 3 : PC3 cell extract
    Lane 4 : Ho8910 cell extract
    Lane 5 : Mouse liver extract

    Predicted band size: 52 kDa

References

ab180614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up