Overview

  • Product name
  • Description
    Mouse polyclonal to AP1M1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human AP1M1 aa 1-74. (NP_115882).
    Sequence:

    MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPIL AHGGVRFMWIKHNNLYLVATSKKN


    Database link: Q9BXS5

  • Positive control
    • U-2 OS cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab194384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 49 kDa.

Target

  • Function
    Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
  • Sequence similarities
    Belongs to the adaptor complexes medium subunit family.
    Contains 1 MHD (mu homology) domain.
  • Post-translational
    modifications
    Phosphorylation of membrane-bound AP1M1/AP1M2 increases its affinity for sorting signals.
  • Cellular localization
    Golgi apparatus. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
  • Information by UniProt
  • Database links
  • Alternative names
    • Adaptor protein complex AP-1 mu-1 subunit antibody
    • Adaptor-related protein complex 1 mu-1 subunit antibody
    • AP-1 complex subunit mu-1 antibody
    • AP-mu chain family member mu1A antibody
    • Ap1m1 antibody
    • AP1M1_HUMAN antibody
    • AP47 antibody
    • CLAPM2 antibody
    • Clathrin adaptor protein AP47 antibody
    • Clathrin assembly protein complex 1 medium chain 1 antibody
    • Clathrin assembly protein complex 1 medium chain antibody
    • Clathrin assembly protein complex AP1 mu subunit antibody
    • Clathrin coat assembly protein AP47 antibody
    • Clathrin coat-associated protein AP47 antibody
    • CLTNM antibody
    • Golgi adaptor AP 1 47 kDa protein antibody
    • Golgi adaptor HA1/AP1 adaptin mu-1 subunit antibody
    • HA1 47 kDa subunit antibody
    • MU 1A antibody
    • Mu-adaptin 1 antibody
    • Mu1A-adaptin antibody
    see all

Images

  • Anti-AP1M1 antibody (ab194384) at 1/1000 dilution + recombinant mouse AP1M1 (immunogen) at 0.2 µg

    Predicted band size : 49 kDa

    Predicted MW of immunogen: 34.25 KDa

  • Anti-AP1M1 antibody (ab194384) at 1/500 dilution + U-2 OS cell lysate at 50 µg

    Predicted band size : 49 kDa

References

ab194384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up