Anti-AP5S1 antibody - N-terminal (ab185096)

Overview

  • Product name
    Anti-AP5S1 antibody - N-terminal
    See all AP5S1 primary antibodies
  • Description
    Rabbit polyclonal to AP5S1 - N-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human AP5S1 aa 12-89 (N terminal).
    Sequence:

    APNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQV ESMCRLQQQASGRPPMDLQPQSSDEQVP


    Database link: Q9NUS5

  • Positive control
    • Human pancreas tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol

Target

  • Function
    As part of AP-5, a probable fifth adapter protein complex it may be involved in endosomal transport. According to PubMed:20613862, it is required for efficient homologous recombination DNA double-strand break repair.
  • Cellular localization
    Cytoplasm > cytosol. Late endosome membrane. Lysosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Adapter-related protein complex 5 sigma subunit antibody
    • adaptor related protein complex 5 sigma 1 subunit antibody
    • AP-5 complex subunit sigma-1 antibody
    • AP5S1 antibody
    • AP5S1_HUMAN antibody
    • C20orf29 antibody
    • protein C20orf29 antibody
    • Sigma5 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling AP5S1 with ab185096 at 1/200 dilution

References

ab185096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up