Overview

  • Product nameAnti-APAF1 antibody
    See all APAF1 primary antibodies
  • Description
    Chicken polyclonal to APAF1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide: PEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKS SSYDYEALDEAMSISVEMLREDIKDYYTDLSI, corresponding to amino acids 307-388 of Human APAF1.

Properties

Applications

Our Abpromise guarantee covers the use of ab14228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 139 kDa.

Target

  • FunctionOligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP. Isoform 6 is less effective in inducing apoptosis.
  • Tissue specificityUbiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
  • Sequence similaritiesContains 1 CARD domain.
    Contains 1 NB-ARC domain.
    Contains 13 WD repeats.
  • DomainThe CARD domain mediates interaction with APIP.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • APAF 1 antibody
    • Apaf-1 antibody
    • APAF_HUMAN antibody
    • Apaf1 antibody
    • Apoptotic peptidase activating factor 1 antibody
    • Apoptotic protease activating factor 1 antibody
    • Apoptotic protease activating factor antibody
    • Apoptotic protease-activating factor 1 antibody
    • CED 4 antibody
    • CED4 antibody
    • KIAA0413 antibody
    see all

Anti-APAF1 antibody images



  • Predicted band size : 139 kDa


    Western blot analysis of APAF1 with an E coli-derived fusion protein as test antigen, using ab14228 diluted 1/2000.

References for Anti-APAF1 antibody (ab14228)

ab14228 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab14228.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"