Overview

  • Product nameAnti-APOBEC3B antibody
    See all APOBEC3B primary antibodies
  • Description
    Rabbit polyclonal to APOBEC3B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 78-127 (

    NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW

    ) of human APOBEC3B (NP_004891).

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab104759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Predicted molecular weight: 46 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceAPOBEC3B is a member of the cytidine deaminase gene family. However, it lacks cytidine deaminase activity, at least on RNA molecules (monomeric nucleoside substrates or synthetic apoB, NF1 and NAT1 RNA template). It binds to apoB and AU-rich RNAs. It is unable to reduce HIV-1 infectivity in vitro.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • A3B antibody
    • APOBEC1L antibody
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3B antibody
    • ARCD3 antibody
    • ARP4 antibody
    • bK150C2.2 antibody
    • Cytidine deaminase antibody
    • DJ742C19.2 antibody
    • DNA dC->dU-editing enzyme APOBEC-3B antibody
    • FLJ21201 antibody
    • Phorbolin 1 related protein antibody
    • Phorbolin 2 antibody
    • Phorbolin 2/3 antibody
    • Phorbolin 3 antibody
    • PHRBNL antibody
    • Probable DNA dC>dU editing enzyme APOBEC3B antibody
    see all

Anti-APOBEC3B antibody images

  • Anti-APOBEC3B antibody (ab104759) at 0.25 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 46 kDa

References for Anti-APOBEC3B antibody (ab104759)

ab104759 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"