Overview

  • Product nameAnti-Apolipoprotein H antibody
    See all Apolipoprotein H primary antibodies
  • Description
    Rabbit polyclonal to Apolipoprotein H
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Pig, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (

    PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG

    ) of Human Apolipoprotein H (NP_000033)

  • Positive control
    • Human Fetal Spleen Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 4 - 8 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionBinds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells.
  • Tissue specificityExpressed by the liver and secreted in plasma.
  • Sequence similaritiesContains 4 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications
    N- and O-glycosylated. PubMed:6587378 also reports glycosylation on 'Asn-188' for their allele.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activated protein C binding protein antibody
    • Activated protein C-binding protein antibody
    • Anticardiolipin cofactor antibody
    • APC inhibitor antibody
    • Apo-H antibody
    • APOH antibody
    • APOH_HUMAN antibody
    • apolipoprotein H (beta-2-glycoprotein I) antibody
    • Apolipoprotein H antibody
    • B2G1 antibody
    • B2GP1 antibody
    • B2GPI antibody
    • Beta 2 glycoprotein I antibody
    • Beta 2 glycoprotein I precursor antibody
    • Beta(2)GPI antibody
    • Beta-2-glycoprotein 1 antibody
    • Beta-2-glycoprotein I antibody
    • BG antibody
    • Glycoprotein 1, beta-2 antibody
    • Glycoprotein I, beta-2 antibody
    • OTTMUSP00000003033 antibody
    see all

Anti-Apolipoprotein H antibody images

  • Anti-Apolipoprotein H antibody (ab99123) at 1 µg/ml + Human Fetal Spleen Lysate at 10 µg

    Predicted band size : 38 kDa
    12% SDS PAGE
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human tonsil tissue labelling Apolipoprotein H with ab99123 at 4-8µg/ml.

References for Anti-Apolipoprotein H antibody (ab99123)

ab99123 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"