Overview

  • Product name
    Anti-Apoptin antibody
  • Description
    Rabbit polyclonal to Apoptin
  • Specificity
    Reacts with Chicken anemia virus.
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Other
  • Immunogen

    Full length protein corresponding to Apoptin aa 1-121. (Chicken anemia virus).
    Sequence:

    MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRIGIAGITITLSLCGCA NARAPTLRSATADNSESTGFKNVPDLRTDQPKPPSKKRSCDPSEYRVSEL KESLITTTPSRPRTAKRRIRL


    Database link: Q99152

  • Positive control
    • WB: Chicken anemia virus Apoptin-GST fusion protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    > 95%
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 13 kDa.
ELISA Use at an assay dependent concentration.

Target

Images

  • Anti-Apoptin antibody (ab193612) at 2 µg/ml + Chicken anemia virus apoptin at 0.4 µg

    Secondary
    Polyclonal goat anti-rabbit at 1/10000 dilution

    Predicted band size : 13 kDa
    Observed band size : 40 kDa (why is the actual band size different from the predicted?)

References

This product has been referenced in:
  • Wu F  et al. Human serum albumin-mediated apoptin delivery suppresses breast cancer cell growth in vitro and in vivo. Oncol Lett 13:579-586 (2017). Read more (PubMed: 28356932) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up