Overview

  • Product nameAnti-APXL antibody
    See all APXL primary antibodies
  • Description
    Rabbit polyclonal to APXL
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 1296-1345 of Human APXL (

    TSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTMD

    ); NP_001640

  • Positive control
    • Fetal lung lysate (Human)

Properties

Applications

Our Abpromise guarantee covers the use of ab86265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 176 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in endothelial cell morphology changes during cell spreading. In the retinal pigment epithelium, may regulate the biogenesis of melanosomes and promote their association with the apical cell surface by inducing gamma-tubulin redistribution.
  • Tissue specificityAbundant in retina and melanoma; also in brain, placenta, lung, kidney and pancreas.
  • Sequence similaritiesBelongs to the shroom family.
    Contains 1 ASD1 domain.
    Contains 1 ASD2 domain.
    Contains 1 PDZ (DHR) domain.
  • DomainThe ASD1 domain mediates F-actin binding.
  • Cellular localizationApical cell membrane. Cell junction > tight junction. Cytoplasm > cytoskeleton. Associates with cortical F-actin.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4832440C16 antibody
    • Ab2-404 antibody
    • Apical like protein antibody
    • Apical like protein APXL protein antibody
    • apical protein of Xenopus-like antibody
    • Apical protein Xenopus laevis like antibody
    • apical protein, Xenopus laevis-like antibody
    • apical protein-like antibody
    • apical protein-like (Xenopus laevis) antibody
    • Apical-like protein antibody
    • APX homolog of Xenopus antibody
    • C630003H05Rik antibody
    • DKFZp781J074 antibody
    • FLJ39277 antibody
    • HSAPXL antibody
    • Liver regeneration-related protein LRRG167 antibody
    • OTTHUMP00000022887 antibody
    • Protein Apxl antibody
    • Protein Shroom2 antibody
    • Shrm2 antibody
    • SHRM2_HUMAN antibody
    • SHROOM 2 antibody
    • Shroom family member 2 antibody
    • shroom2 antibody
    see all

Anti-APXL antibody images

  • Anti-APXL antibody (ab86265) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal lung lysate (Human) at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 176 kDa
    Observed band size : 176 kDa
    Additional bands at : 90 kDa. We are unsure as to the identity of these extra bands.

References for Anti-APXL antibody (ab86265)

ab86265 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"