Overview

  • Product nameAnti-Aquaporin 10 antibody
    See all Aquaporin 10 primary antibodies
  • Description
    Rabbit polyclonal to Aquaporin 10
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    A synthetic peptide within C terminal amino acids 253-302 of Human AQP10 (

    GATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL

    )

  • Positive control
    • Jurkat cell lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab81179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent dilution.

Target

  • FunctionWater channel required to promote glycerol permeability and water transport across cell membranes. May contribute to water transport in the upper portion of small intestine. Isoform 2 is not permeable to urea and glycerol.
  • Tissue specificityExpressed exclusively in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of villi in the jejunum.
  • Sequence similaritiesBelongs to the MIP/aquaporin (TC 1.A.8) family.
  • DomainAquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AQP 10 antibody
    • AQP-10 antibody
    • AQP10 antibody
    • AQP10_HUMAN antibody
    • AQPA Human antibody
    • Aquaglyceroporin-10 antibody
    • Aquaporin-10 antibody
    • Aquaporin10 antibody
    • Small intestine aquaporin antibody
    see all

Anti-Aquaporin 10 antibody images

  • Anti-Aquaporin 10 antibody (ab81179) at 1 µg/ml + Jurkat Cell Lysate at 10 µg

    Predicted band size : 32 kDa

References for Anti-Aquaporin 10 antibody (ab81179)

ab81179 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"