Overview

  • Product name
    Anti-Aquaporin 10 antibody
    See all Aquaporin 10 primary antibodies
  • Description
    Rabbit polyclonal to Aquaporin 10
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    A synthetic peptide within C terminal amino acids 253-302 of Human AQP10 (

    GATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL

    )

  • Positive control
    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab81179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent dilution.

Target

  • Function
    Water channel required to promote glycerol permeability and water transport across cell membranes. May contribute to water transport in the upper portion of small intestine. Isoform 2 is not permeable to urea and glycerol.
  • Tissue specificity
    Expressed exclusively in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of villi in the jejunum.
  • Sequence similarities
    Belongs to the MIP/aquaporin (TC 1.A.8) family.
  • Domain
    Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AQP 10 antibody
    • AQP-10 antibody
    • AQP10 antibody
    • AQP10_HUMAN antibody
    • AQPA Human antibody
    • Aquaglyceroporin-10 antibody
    • Aquaporin-10 antibody
    • Aquaporin10 antibody
    • Small intestine aquaporin antibody
    see all

Images

  • Anti-Aquaporin 10 antibody (ab81179) at 1 µg/ml + Jurkat Cell Lysate at 10 µg

    Predicted band size : 32 kDa

References

ab81179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up