Overview

  • Product name
  • Description
    Rabbit polyclonal to Arg 3.1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat
    Predicted to work with: Goat, Guinea pig, Cow, Human
  • Immunogen

    Synthetic peptide within Mouse Arg 3.1 aa 101-150 (internal sequence). The exact sequence is proprietary.
    Sequence:

    TIANLERWVKREMHVWREVFYRLERWADRLESMGGKYPVGSEPARHTVSV


    Database link: NP_061260.1

  • Positive control
    • WB: Mouse brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab118929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration.
  • Sequence similarities
    Belongs to the ARC/ARG3.1 family.
  • Cellular localization
    Cytoplasm, cytoskeleton. Endosome. Cytoplasmic vesicle, secretory vesicle, acrosome. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, dendrite. Cell projection, dendritic spine. Cell junction, synapse. Associated with the cell cortex of neuronal soma and dendrites. Enriched in postsynaptic density of dendritic spines. Associated with the sperm tail (By similarity). Enriched on the plasma membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activity regulated cytoskeletal associated protein antibody
    • Activity regulated cytoskeletal protein antibody
    • Activity regulated gene 3.1 protein homolog antibody
    • Activity-regulated cytoskeleton-associated protein antibody
    • Activity-regulated gene 3.1 protein homolog antibody
    • Arc antibody
    • ARC/ARG3.1 antibody
    • ARC_HUMAN antibody
    • Arg3.1 antibody
    • KIAA0278 antibody
    see all

Images

  • Anti-Arg 3.1 antibody (ab118929) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size : 45 kDa
    Gel concentration: 12%

References

This product has been referenced in:
  • Liu ZH  et al. Early developmental bisphenol-A exposure sex-independently impairs spatial memory by remodeling hippocampal dendritic architecture and synaptic transmission in rats. Sci Rep 6:32492 (2016). WB ; Rat . Read more (PubMed: 27578147) »
  • Goard MJ  et al. Distinct roles of visual, parietal, and frontal motor cortices in memory-guided sensorimotor decisions. Elife 5:N/A (2016). Histology . Read more (PubMed: 27490481) »

See all 4 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab118929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up