Overview

  • Product name
  • Description
    Mouse polyclonal to ARHGAP1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, Recombinant fragment
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human ARHGAP1 aa 340-439 (C terminal). NCBI Accession No. AAH18118.
    Sequence:

    GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTN TNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL


    Database link: Q07960

  • Positive control
    • MES-SA/Dx5, jurkat, mouse NIH3T3, mouse Raw 264.7 and rat PC12 cell lysates; recombinant ARHGAP1 protein fragment.

Properties

Applications

Our Abpromise guarantee covers the use of ab194425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 50 kDa.

Target

  • Function
    GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 CRAL-TRIO domain.
    Contains 1 Rho-GAP domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHGAP 1 antibody
    • Arhgap1 antibody
    • CDC42 GTPase activating protein antibody
    • Cdc42 GTPase-activating protein antibody
    • CDC42GAP antibody
    • GTPase activating protein rhoOGAP antibody
    • GTPase-activating protein rhoOGAP antibody
    • GTPase-activating protein, Rho, 1 antibody
    • OTTHUMP00000233485 antibody
    • OTTHUMP00000233486 antibody
    • p50 RhoGAP antibody
    • p50-RhoGAP antibody
    • p50rhoGAP antibody
    • RHG01_HUMAN antibody
    • Rho GTPase activating protein 1 antibody
    • Rho GTPase-activating protein 1 antibody
    • Rho related small GTPase protein activator antibody
    • Rho type GTPase activating protein 1 antibody
    • Rho-related small GTPase protein activator antibody
    • Rho-type GTPase-activating protein 1 antibody
    • RHOGAP antibody
    • RHOGAP1 antibody
    see all

Images

  • Anti-ARHGAP1 antibody (ab194425) at 1/1000 dilution + recombinant ARHGAP1 protein fragment at 0.2 µg
    Developed using the ECL technique

    Predicted band size : 50 kDa
  • Anti-ARHGAP1 antibody (ab194425) at 1/500 dilution + rat PC12 cell lysate at 50 µg
    Developed using the ECL technique

    Predicted band size : 50 kDa
  • Anti-ARHGAP1 antibody (ab194425) at 1/500 dilution + MES-SA/Dx5 cell lysate at 50 µg
    Developed using the ECL technique

    Predicted band size : 50 kDa
  • Anti-ARHGAP1 antibody (ab194425) at 1/500 dilution + mouse Raw 264.7 cell lysate at 50 µg
    Developed using the ECL technique

    Predicted band size : 50 kDa
  • Anti-ARHGAP1 antibody (ab194425) at 1/500 dilution + Jurkat cell lysate at 50 µg
    Developed using the ECL technique

    Predicted band size : 50 kDa
  • Anti-ARHGAP1 antibody (ab194425) at 1/500 dilution + mouse NIH 3T3 cell lysate at 50 µg
    Developed using the ECL technique

    Predicted band size : 50 kDa

References

This product has been referenced in:
  • Li JP  et al. ARHGAP1 overexpression inhibits proliferation, migration and invasion of C-33A and SiHa cell lines. Onco Targets Ther 10:691-701 (2017). WB ; Human . Read more (PubMed: 28223826) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up