Anti-ARHGEF4 antibody [ARHGEF-08] (ab178551)

Overview

  • Product name
    Anti-ARHGEF4 antibody [ARHGEF-08]
    See all ARHGEF4 primary antibodies
  • Description
    Mouse monoclonal [ARHGEF-08] to ARHGEF4
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ARHGEF4 aa 143-271.
    Sequence:

    AMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGGGGEQLAINELIS DGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGW FPASFVRLRVNQDEPADDDAPLAGNSGAE


    Database link: Q9NR80

  • Positive control
    • ARHGEF4 transfected HEK293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 79 kDa.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Relevance
    This protein may form complexes with G proteins and stimulate Rho-dependent signals, and is similar to rat collybistin protein. Rho GTPases play a fundamental role in numerous cellular processes, which are initiated by extracellular stimuli that work through G protein coupled receptors. Alternative splicing of this gene generates two transcript variants which encode different isoforms.
  • Cellular localization
    Cytoplasm. Cell projection; ruffle membrane; Peripheral membrane protein; Cytoplasmic side Probable. Note: Associated with membrane ruffles
  • Database links
  • Alternative names
    • APC stimulated guanine nucleotide exchange factor 1 antibody
    • APC stimulated guanine nucleotide exchange factor antibody
    • ARHGEF 4 antibody
    • Asef antibody
    • ASEF1 antibody
    • GEF 4 antibody
    • GEF antibody
    • GEF4 antibody
    • KIAA1112 antibody
    • Rho guanine nucleotide exchange factor (GEF) 4 antibody
    • Rho guanine nucleotide exchange factor 4 antibody
    • STM 6 antibody
    • STM6 antibody
    see all

Images

  • All lanes : Anti-ARHGEF4 antibody [ARHGEF-08] (ab178551) at 1/1000 dilution

    Lane 1 : Non-transfected HEK293 cell lysate
    Lane 2 : ARHGEF4 transfected HEK293 cell lysate

    Predicted band size: 79 kDa

References

ab178551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up