Overview

  • Product name
  • Description
    Rabbit polyclonal to ARHGEF7
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, African green monkey
  • Immunogen

    Recombinant full length protein corresponding to Human ARHGEF7 aa 1-803.
    Sequence:

    MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLP GTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTI LLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHR IKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNE DELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSP KSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGG CFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILV LTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQC QEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNE RYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEI SGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLP SH PVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKT PKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDE EFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLA DDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRKSCC SYISHQN


    Database link: Q14155

  • Positive control
    • Jurkat, Cos-1, Cos-7, MCF-7, K562, lung and heart lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab175306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 90 kDa.

Target

  • Function
    Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. May function as a positive regulator of apoptosis. May function in cell migration.
  • Sequence similarities
    Contains 1 CH (calponin-homology) domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHG7 antibody
    • ARHG7_HUMAN antibody
    • ARHGEF 7 antibody
    • Arhgef7 antibody
    • Beta pix antibody
    • Beta-Pix antibody
    • betaPix antibody
    • betaPix-b antibody
    • betaPix-c antibody
    • Cool antibody
    • COOL-1 antibody
    • COOL1 antibody
    • DKFZp686C12170 antibody
    • DKFZp761K1021 antibody
    • KIAA0142 antibody
    • KIAA0412 antibody
    • mKIAA0142 antibody
    • Nbla10314 antibody
    • P50 antibody
    • P50BP antibody
    • p85 antibody
    • P85COOL1 antibody
    • P85SPR antibody
    • PAK interacting exchange factor beta antibody
    • PAK-interacting exchange factor beta antibody
    • PAK3 antibody
    • Pak3bp antibody
    • PIX antibody
    • PIXB antibody
    • Rho guanine nucleotide exchange factor (GEF) 7 antibody
    • Rho guanine nucleotide exchange factor (GEF) 7b antibody
    • Rho guanine nucleotide exchange factor (GEF7) antibody
    • Rho guanine nucleotide exchange factor 7 antibody
    • SH3 domain containing proline rich protein antibody
    see all

Images

  • All lanes : Anti-ARHGEF7 antibody (ab175306) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : Cos-1 cell lysate
    Lane 3 : Cos-7 cell lysate
    Lane 4 : MCF-7 cell lysate
    Lane 5 : K562 cell lysate
    Lane 6 : Lung lysate
    Lane 7 : Heart lysate


    Predicted band size : 90 kDa

References

ab175306 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up