Overview

  • Product nameAnti-ARL17B antibody
    See all ARL17B primary antibodies
  • Description
    Rabbit polyclonal to ARL17B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 108-157 (CSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD L) of Human ARL17B (NP_001034172).

  • Positive control
    • Placenta lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ARL17B antibody images

  • Anti-ARL17B antibody (ab94438) at 1 µg/ml + Placenta lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 19 kDa

References for Anti-ARL17B antibody (ab94438)

ab94438 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"