Overview

  • Product name
  • Description
    Rabbit polyclonal to ARMC2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human ARMC2 aa 652-748.
    Sequence:

    NATATINNLSYYQVKNSIIQDKKLYIAELLLKLLVSNNMDGILEAVRVFG NLSQDHDVCDFIVQNNVHRFMMALLDAQHQDICFSACGVLLNLTVDK


    Database link: Q8NEN0

  • Positive control
    • ICC/IF: SiHa (human cervical carcinoma cell line) cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • PFA fixed/ Triton X-100 permeabilized SiHa (human cervical carcinoma cell line) cells stained for ARMC2 (green) using ab222385 at 4 µg/ml in ICC/IF.

References

ab222385 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up