Overview

  • Product name
  • Description
    Rabbit polyclonal to ARP19
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human ARP19 aa 1-31.
    Sequence:

    MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK


    Database link: P56211

  • Positive control
    • Human placenta tissue, adrenal gland tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab188615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-62 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase. May indirectly enhance GAP-43 expression.
  • Sequence similarities
    Belongs to the endosulfine family.
  • Post-translational
    modifications
    Phosphorylation at Ser-62 by GWL during mitosis is essential for interaction with PPP2R2D (PR55-delta) and subsequent inactivation of PP2A (By similarity). Phosphorylated by PKA.
    Isoform ARPP-16 contains a N-acetylmethionine at position 1.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARP19_HUMAN antibody
    • ARPP-19 antibody
    • Arpp19 antibody
    • cAMP-regulated phosphoprotein 19 antibody

Images

  • Immunohistochemical analysis of paraffin embedded Human adrenal gland tissue staining ARP19 using ab188615 at a 1/200 dilution.

  • Immunohistochemical analysis of paraffin embedded Human placenta tissue staining ARP19 using ab188615 at a 1/200 dilution

References

ab188615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up