Overview

  • Product name
    Anti-ARS2 antibody - N-terminal
    See all ARS2 primary antibodies
  • Description
    Rabbit polyclonal to ARS2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Horse, Cow, Dog, Pig, Xenopus laevis, Chimpanzee, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human ARS2 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_056992.4).
    Sequence:

    MGDSDDEYDRRRRDKFRRERSDYDRSRERDERRRGDDWNDREWDRGRERR


    Database link: Q9BXP5

  • Positive control
    • HeLa, 293T, Jurkat, TCMK-1 and NIH 3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab192999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 101 kDa.

Target

Images

  • All lanes : Anti-ARS2 antibody - N-terminal (ab192999) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 101 kDa


    Exposure time: 3 minutes


    Lysates prepared using NETN lysis buffer.

  • Detection of ARS2 in immunoprecipitates of Jurkat whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab192999 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 3 minutes.

References

ab192999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up