
  • Product name
  • Description
    Rabbit polyclonal to ARSE
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 503-552 (KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTL S) of Human ARSE (NP_000038)

  • Positive control
    • Placenta lysate.



Our Abpromise guarantee covers the use of ab83458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 62 kDa (predicted molecular weight: 62 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix.
  • Cellular localization
    Golgi apparatus, Golgi stack.
  • Database links
  • Alternative names
    • Arylsulfatase E (chondrodysplasia punctata 1) antibody
    • Arylsulfatase E antibody
    • Arylsulfatase E; chondrodysplasia punctata 1 antibody
    • CDPX antibody
    • CDPX1 antibody
    • CDPXR antibody
    • MGC163310 antibody
    • OTTHUMP00000022851 antibody
    see all

Anti-ARSE antibody images

  • Anti-ARSE antibody (ab83458) at 1 µg/ml + placenta lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 62 kDa
    Observed band size : 62 kDa

References for Anti-ARSE antibody (ab83458)

ab83458 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83458.
Please use the links above to contact us or submit feedback about this product.


Sign up