Overview

  • Product name
  • Description
    Rabbit polyclonal to ART1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ART1 aa 37-122.
    Sequence:

    IQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQANQVYADSWTLASSQW QERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYT


    Database link: P52961

  • Positive control
    • Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    ART1 belongs to the Arg-specific ADP-ribosyltransferase family. It catalyzes the transfer of ADP-ribose from NAD+ to arginine residues in proteins.
  • Cellular localization
    Sarcoplasmic reticulum membrane; Lipid-anchor, GPI-anchor.
  • Database links
  • Alternative names
    • ADP ribosyltransferase 1 antibody
    • ADP ribosyltransferase 2 antibody
    • ART 1 antibody
    • ART2 antibody
    • CD296 antibody
    • CD296 antigen antibody
    • GPI linked NAD(P)(+) arginine ADP ribosyltransferase 1 antibody
    • MGC133217 antibody
    • Mono(ADP ribosyl)transferase antibody
    • RT6 antibody
    see all

Images

  • Immunohistochemical analysis of Paraffin-embedded Human kidney tissue labeling ART1 with ab185293 at 1/200 dilution.

References

ab185293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up