Anti-Aspartate Aminotransferase antibody - C-terminal (ab189863)

Overview

  • Product name
    Anti-Aspartate Aminotransferase antibody - C-terminal
    See all Aspartate Aminotransferase primary antibodies
  • Description
    Rabbit polyclonal to Aspartate Aminotransferase - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Horse, Cow, Pig, Chimpanzee, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Aspartate Aminotransferase aa 244-413 (C terminal).
    Sequence:

    FVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVR ITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLE ALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGL TTKNLDYVATSIHEAVTKIQ


    Database link: P17174

  • Positive control
    • Jurkat, 293T, HepG2, A549 and HeLa cell extracts; mouse liver, kidney and heart extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 46 kDa.

Target

Images

  • All lanes : Anti-Aspartate Aminotransferase antibody - C-terminal (ab189863) at 1/500 dilution

    Lane 1 : Jurkat cell extract
    Lane 2 : 293T cell extract
    Lane 3 : HepG2 cell extract
    Lane 4 : A549 cell extract
    Lane 5 : HeLa cell extract
    Lane 6 : mouse liver extract
    Lane 7 : mouse kidney extract
    Lane 8 : mouse heart extract

    Predicted band size: 46 kDa

References

ab189863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up